PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe5G426300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family LBD
Protein Properties Length: 168aa    MW: 18993.9 Da    PI: 7.3661
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe5G426300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260123.61e-3851051101
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCk+lrr+C++dC++a yfp++++++fa+vhk+FGasnv k+lkalp   r++a++sl yeA+ar++dPvyG+v++i+ +q+ql+ +++
  Aqcoe5G426300.1.p   5 RCAACKYLRRRCPSDCIFALYFPSNNKQRFACVHKIFGASNVGKMLKALPVYLRSEAADSLHYEAQARIQDPVYGCVAMISYYQHQLQVTQQ 96 
                        6******************************************************************************************* PP

             DUF260  93 elallkeel 101
                         la++++++
  Aqcoe5G426300.1.p  97 MLAMAQAQI 105
                        ***999885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.5184105IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-385102IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MIPSRCAACK YLRRRCPSDC IFALYFPSNN KQRFACVHKI FGASNVGKML KALPVYLRSE  60
AADSLHYEAQ ARIQDPVYGC VAMISYYQHQ LQVTQQMLAM AQAQITLYQQ ANLDVQQVQA  120
PPQFNFNNVM QELHLQEPLN TDQLILPDGN IQDLMSPYPN IQDPGLL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00381DAPTransfer from AT3G26620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002318256.23e-48hypothetical protein POPTR_0012s13910g
RefseqXP_011030192.13e-48PREDICTED: LOB domain-containing protein 24-like
SwissprotP594685e-44LBD24_ARATH; LOB domain-containing protein 24
TrEMBLB9I4F94e-48B9I4F9_POPTR; Uncharacterized protein
STRINGPOPTR_0012s13910.11e-47(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.13e-45LOB domain-containing protein 24